GNGT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15675T
Article Name: GNGT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15675T
Supplier Catalog Number: CNA15675T
Alternative Catalog Number: MBL-CNA15675T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-45 of human GNGT1 (NP_068774.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 8kDa
NCBI: 2792
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVE
Target: GNGT1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100