GSTM5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15677T
Article Name: GSTM5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15677T
Supplier Catalog Number: CNA15677T
Alternative Catalog Number: MBL-CNA15677T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human GSTM5 (NP_000842.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 2949
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
Target: GSTM5
Application Dilute: WB: WB,1:500 - 1:2000