HNRNPD Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15679P
Article Name: HNRNPD Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15679P
Supplier Catalog Number: CNA15679P
Alternative Catalog Number: MBL-CNA15679P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human HNRNPD (NP_002129.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 3184
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEI
Target: HNRNPD
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000