SERPINI1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15703T
Article Name: SERPINI1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15703T
Supplier Catalog Number: CNA15703T
Alternative Catalog Number: MBL-CNA15703T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 181-410 of human SERPINI1 (NP_005016.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 5274
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: INAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Target: SERPINI1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100