PP2A-B56delta/PR61delta/PPP2R5D Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PP2A-B56delta/PR61delta/PPP2R5D Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA15707T
• Supplier Catalog Number: CNA15707T
• Alternative Catalog Number: MBL-CNA15707T
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PP2A-B56delta/PR61delta/PP2A-B56delta/PR61delta/PPP2R5D (NP_006236.1).
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 70kDa
• NCBI: 5528
• Buffer: PBS with 0.01% thimerosal,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.01% thimerosal,50% glycerol
• Sequence: LYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRT
• Target: PPP2R5D

Application Notes

• Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200