IL6R Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1570P
Article Name: IL6R Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1570P
Supplier Catalog Number: CNA1570P
Alternative Catalog Number: MBL-CNA1570P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 115-320 of human IL6R (NP_000556.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 3570
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRS
Target: IL6R
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200