p90Rsk/RSK1/RPS6KA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15718T
Article Name: p90Rsk/RSK1/RPS6KA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15718T
Supplier Catalog Number: CNA15718T
Alternative Catalog Number: MBL-CNA15718T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human p90Rsk/RSK1/RPS6KA1 (NP_002944.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 6195
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
Target: RPS6KA1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200