EAAT1/SLC1A3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15722T
Article Name: EAAT1/SLC1A3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15722T
Supplier Catalog Number: CNA15722T
Alternative Catalog Number: MBL-CNA15722T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 453-542 of human EAAT1/EAAT1/SLC1A3 (NP_004163.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 6507
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: IVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM
Target: SLC1A3
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200