TCHH Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15731T
Article Name: TCHH Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15731T
Supplier Catalog Number: CNA15731T
Alternative Catalog Number: MBL-CNA15731T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human TCHH (NP_009044.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 254kDa
NCBI: 7062
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RARCDGKESLLQDRRQEEDQRRFEPRDRQLEEEPGQRRRQKRQEQERELAEGEEQSEKQERLEQRDRQRRDEELWRQRQEWQEREERRAEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQEEEEKEWRKRETVLRKEEEKLQEEEPQRQRELQEEEEQLRKLERQELRRERQEEEQQQQRL
Target: TCHH
Application Dilute: WB: WB,1:500 - 1:2000