KDM5C Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA15740P
| Article Name: |
KDM5C Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA15740P |
| Supplier Catalog Number: |
CNA15740P |
| Alternative Catalog Number: |
MBL-CNA15740P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human KDM5C (XP_011529128.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
176kDa |
| NCBI: |
8242 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
ERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL |
| Target: |
KDM5C |
| Application Dilute: |
WB: WB,1:1000 - 1:5000 |
