ACTR1B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15773T
Article Name: ACTR1B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15773T
Supplier Catalog Number: CNA15773T
Alternative Catalog Number: MBL-CNA15773T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human ACTR1B (NP_005726.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 10120
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEE
Target: ACTR1B
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200