TENM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15774T
Article Name: TENM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15774T
Supplier Catalog Number: CNA15774T
Alternative Catalog Number: MBL-CNA15774T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-540 of human TENM1 (NP_001156750.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 305kDa
NCBI: 10178
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: QPVEGELYANGVSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQHSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
Target: TENM1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200