[KO Validated] SEC61B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15788T
Article Name: [KO Validated] SEC61B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15788T
Supplier Catalog Number: CNA15788T
Alternative Catalog Number: MBL-CNA15788T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 10952
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
Target: SEC61B
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200