KDM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15794T
Article Name: KDM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15794T
Supplier Catalog Number: CNA15794T
Alternative Catalog Number: MBL-CNA15794T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 365-515 of human KDM1 (NP_055828.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 23028
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANP
Target: KDM1A
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100