NBEAL2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15797T
Article Name: NBEAL2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15797T
Supplier Catalog Number: CNA15797T
Alternative Catalog Number: MBL-CNA15797T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1800-2100 of human NBEAL2 (NP_055990.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 303kDa
NCBI: 23218
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LLHWGALWRQLASPCGAWALRDTPIPRWKLSSAETYSRMRLKLVPNHHFDPHLEASALRDNLGEVPLTPTEEASLPLAVTKEAKVSTPPELLQEDQLGEDELAELETPMEAAELDEQREKLVLSAECQLVTVVAVVPGLLEVTTQNVYFYDGSTERVETEEGIGYDFRRPLAQLREVHLRRFNLRRSALELFFIDQANYFLNFPCKVGTTPVSSPSQTPRPQPGPIPPHTQVRNQVYSWLLRLRPPSQGYLSSR
Target: NBEAL2
Application Dilute: WB: WB,1:500 - 1:2000