PPA2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15819T
Article Name: PPA2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15819T
Supplier Catalog Number: CNA15819T
Alternative Catalog Number: MBL-CNA15819T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 33-100 of human PPA2 (NP_008834.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 27068
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPR
Target: PPA2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100