RPS27L Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA15833T
Article Name: |
RPS27L Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA15833T |
Supplier Catalog Number: |
CNA15833T |
Alternative Catalog Number: |
MBL-CNA15833T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-84 of human RPS27L (NP_057004.1). |
Conjugation: |
Unconjugated |
Clonality: |
Polyclonal |
Molecular Weight: |
9kDa |
NCBI: |
51065 |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH |
Target: |
RPS27L |
Application Dilute: |
WB: WB,1:500 - 1:2000 |