TRIM62 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15855T
Article Name: TRIM62 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15855T
Supplier Catalog Number: CNA15855T
Alternative Catalog Number: MBL-CNA15855T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human TRIM62 (NP_060677.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 55223
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HEQHQVTGIDDAFDELQRELKDQLQALQDSEREHTEALQLLKRQLAETKSSTKSLRTTIGEAFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAETDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQY
Target: TRIM62
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200