ELP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15857T
Article Name: ELP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15857T
Supplier Catalog Number: CNA15857T
Alternative Catalog Number: MBL-CNA15857T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-600 of human ELP2 (NP_001229808.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 55250
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: QNTVNPREWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTRLFAPWKRKDQSQVTWHEIARPQIHGYDLKCLAMINRFQFVSGADEKVLRVFSAPRNFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNKAVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKKEHAAIILWNTTSWKQVQNLVFHSLTVTQMAFS
Target: ELP2
Application Dilute: WB: WB,1:500 - 1:2000