DDX43 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15858T
Article Name: DDX43 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15858T
Supplier Catalog Number: CNA15858T
Alternative Catalog Number: MBL-CNA15858T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 429-648 of human DDX43 (NP_061135.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 73kDa
NCBI: 55510
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: TWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKVIVFVSRKAVADHLSSDLILGNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQKREMERKMERPQGRPKKFH
Target: DDX43
Application Dilute: WB: WB,1:500 - 1:2000