CCDC47 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15871T
Article Name: CCDC47 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15871T
Supplier Catalog Number: CNA15871T
Alternative Catalog Number: MBL-CNA15871T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 224-483 of human CCDC47 (NP_064583.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 57003
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: FLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQ
Target: CCDC47
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200