ATP10A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15873T
Article Name: ATP10A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15873T
Supplier Catalog Number: CNA15873T
Alternative Catalog Number: MBL-CNA15873T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 440-690 of human ATP10A (NP_077816.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 168kDa
NCBI: 57194
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQRGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELKSPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERE
Target: ATP10A
Application Dilute: WB: WB,1:500 - 1:2000