CYB5B Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA15900T
| Article Name: |
CYB5B Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA15900T |
| Supplier Catalog Number: |
CNA15900T |
| Alternative Catalog Number: |
MBL-CNA15900T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 16-150 of human CYB5B (NP_085056.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
17kDa |
| NCBI: |
80777 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS |
| Target: |
CYB5B |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
