PTPN1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1590P
Article Name: PTPN1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1590P
Supplier Catalog Number: CNA1590P
Alternative Catalog Number: MBL-CNA1590P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 281-435 of human PTPN1 (NP_002818.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 5770
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Target: PTPN1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200