PPIL4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15920T
Article Name: PPIL4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15920T
Supplier Catalog Number: CNA15920T
Alternative Catalog Number: MBL-CNA15920T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 301-492 of human PPIL4 (NP_624311.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 85313
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLVLKDKVKPKQDTKYDLILDEQAEDSKSSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSPKKSKDKEKSKYR
Target: PPIL4
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200