TP53I13 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15924T
Article Name: TP53I13 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15924T
Supplier Catalog Number: CNA15924T
Alternative Catalog Number: MBL-CNA15924T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 180-310 of human TP53I13 (NP_612358.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 90313
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RSWRPPGTEVTSQGPRQPSSSGAKRRRLRAALGPQPTRSALRFPSASPGSLKAKQSMAGIPGRESNAPSVPTVSLLPGAPGGNASSRTEAQVPNGQGSPGGCVCSSQASPAPRAAAPPRAARGPTPRTEEA
Target: TP53I13
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200