Bad Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1593S
Article Name: Bad Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1593S
Supplier Catalog Number: CNA1593S
Alternative Catalog Number: MBL-CNA1593S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 110 to the C-terminus of human Bad (NP_004313.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 572
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: YGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
Target: BAD
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:10 - 1:100