NAXE Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15952T
Article Name: NAXE Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15952T
Supplier Catalog Number: CNA15952T
Alternative Catalog Number: MBL-CNA15952T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 48-170 of human NAXE (NP_658985.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 128240
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP
Target: NAXE
Application Dilute: WB: WB,1:500 - 1:2000