C9orf72 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15970T
Article Name: C9orf72 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15970T
Supplier Catalog Number: CNA15970T
Alternative Catalog Number: MBL-CNA15970T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 9-200 of human C9orf72 (NP_001242983.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 203228
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEID
Target: C9orf72
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200