ZNRF3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16026S1
Article Name: ZNRF3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16026S1
Supplier Catalog Number: CNA16026S1
Alternative Catalog Number: MBL-CNA16026S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ZNRF3 (NP_001193927.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 101kDa
NCBI: 84133
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: PGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRG
Target: ZNRF3
Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200