GLS2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16029P
Article Name: GLS2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16029P
Supplier Catalog Number: CNA16029P
Alternative Catalog Number: MBL-CNA16029P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-602 of human GLS2 (NP_037399.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 27165
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIEACKVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESMV
Target: GLS2
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200