Cyclin B1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16038P
Article Name: Cyclin B1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16038P
Supplier Catalog Number: CNA16038P
Alternative Catalog Number: MBL-CNA16038P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 334-433 of human Cyclin B1 (NP_114172.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 891
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: YDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Target: CCNB1
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100