CLNS1A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16040T
Article Name: CLNS1A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16040T
Supplier Catalog Number: CNA16040T
Alternative Catalog Number: MBL-CNA16040T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human CLNS1A (NP_001284.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 1207
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Target: CLNS1A
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100