IGHMBP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16053T
Article Name: IGHMBP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16053T
Supplier Catalog Number: CNA16053T
Alternative Catalog Number: MBL-CNA16053T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of human IGHMBP2 (NP_002171.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 109kDa
NCBI: 3508
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PYNLQVDLLRQSLVHRHPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQGSSHAATKPQGPATSTRTGSQRQEGGQEAAAPARQGRKKPAGKSLASEAPSQPSLNGGSPEGV
Target: IGHMBP2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100