MLF2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16076T
Article Name: MLF2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16076T
Supplier Catalog Number: CNA16076T
Alternative Catalog Number: MBL-CNA16076T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human MLF2 (NP_005430.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 8079
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVS
Target: MLF2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200