MTA1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA16085P
| Article Name: |
MTA1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA16085P |
| Supplier Catalog Number: |
CNA16085P |
| Alternative Catalog Number: |
MBL-CNA16085P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MTA1 (NP_004680.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
81kDa |
| NCBI: |
9112 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
LMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP |
| Target: |
MTA1 |
| Application Dilute: |
WB: WB,1:1000 - 1:5000 |
