EPN2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16106T
Article Name: EPN2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16106T
Supplier Catalog Number: CNA16106T
Alternative Catalog Number: MBL-CNA16106T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-300 of human EPN2 (NP_683723.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 22905
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: GINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPS
Target: EPN2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200