TRAPPC6A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16143T
Article Name: TRAPPC6A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16143T
Supplier Catalog Number: CNA16143T
Alternative Catalog Number: MBL-CNA16143T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human TRAPPC6A (NP_077013.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 79090
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MADTVLFEFLHTEMVAELWAHDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGLLRGALYTLGIESVVTASVAALPVCKFQVVIPKS
Target: TRAPPC6A
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200