BPIFB2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16148T
Article Name: BPIFB2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16148T
Supplier Catalog Number: CNA16148T
Alternative Catalog Number: MBL-CNA16148T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-340 of human BPIFB2 (NP_079503.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 80341
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: IGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLN
Target: BPIFB2
Application Dilute: WB: WB,1:500 - 1:2000