IDO1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1614P
Article Name: IDO1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1614P
Supplier Catalog Number: CNA1614P
Alternative Catalog Number: MBL-CNA1614P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-403 of human IDO1 (NP_002155.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 3620
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWE
Target: IDO1
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200