MED25 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16150T
Article Name: MED25 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16150T
Supplier Catalog Number: CNA16150T
Alternative Catalog Number: MBL-CNA16150T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human MED25 (NP_112235.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 78kDa
NCBI: 81857
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGCTTENLVQQIGERGIHFSIVSPRKLPALRLLFEKAAP
Target: MED25
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200