HPS4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16157T
Article Name: HPS4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16157T
Supplier Catalog Number: CNA16157T
Alternative Catalog Number: MBL-CNA16157T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 387-708 of human HPS4 (NP_071364.4).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 89781
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: FAFLHVPVPDGRAPYCKASLSASSSLEPTPPEDTAISSLRPPSAPEMLTQHGAQEQLEDHPGHSSQAPIPRADPLPRRTRRPLLLPRLDPGQRGNKLPTGEQGLDEDVDGVCESHAAPGLECSSGSANCQGAGPSADGISSRLTPAESCMGLVRMNLYTHCVKGLVLSLLAEEPLLGDSAAIEEVYHSSLASLNGLEVHLKETLPRDEAASTSSTYNFTHYDRIQSLLMANLPQVATPQDRRFLQAVSLMHSEF
Target: HPS4
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200