RNF185 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16158T
Article Name: RNF185 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16158T
Supplier Catalog Number: CNA16158T
Alternative Catalog Number: MBL-CNA16158T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RNF185 (NP_689480.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 91445
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGD
Target: RNF185
Application Dilute: WB: WB,1:500 - 1:2000