MAS1L Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16161T
Article Name: MAS1L Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16161T
Supplier Catalog Number: CNA16161T
Alternative Catalog Number: MBL-CNA16161T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MAS1L (NP_443199.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 116511
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQ
Target: MAS1L
Application Dilute: WB: WB,1:500 - 1:2000