GPR62 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16163T
Article Name: GPR62 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16163T
Supplier Catalog Number: CNA16163T
Alternative Catalog Number: MBL-CNA16163T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR62 (NP_543141.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 118442
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: GTPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYGGIFVVARRAALRPPRPARGSRLHSDSLDSRLSILPPLRPRLPGGKAALAPALAVGQF
Target: GPR62
Application Dilute: WB: WB,1:500 - 1:1000