SLC34A3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA16168T
| Article Name: |
SLC34A3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA16168T |
| Supplier Catalog Number: |
CNA16168T |
| Alternative Catalog Number: |
MBL-CNA16168T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 210-320 of human SLC34A3 (NP_543153.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
64kDa |
| NCBI: |
142680 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
ESATALLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTGQPTQENSSCGAFGPCTEKNSTAPADRLPCRHLFAGTELTD |
| Target: |
SLC34A3 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
