WBSCR27 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16176T
Article Name: WBSCR27 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16176T
Supplier Catalog Number: CNA16176T
Alternative Catalog Number: MBL-CNA16176T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human WBSCR27 (NP_689772.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 155368
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESGRRPRLRK
Target: METTL27
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200