PADI4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16188P
Article Name: PADI4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16188P
Supplier Catalog Number: CNA16188P
Alternative Catalog Number: MBL-CNA16188P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 374-560 of human PADI4 (NP_036519.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 74kDa
NCBI: 23569
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: RGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLA
Target: PADI4
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200