Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16225T
Article Name: Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16225T
Supplier Catalog Number: CNA16225T
Alternative Catalog Number: MBL-CNA16225T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-337 of human Casein Kinase 1 alpha (CSNK1A1) (NP_001883.4).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 1452
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Target: CSNK1A1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200