MRPL18 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16231T
Article Name: MRPL18 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16231T
Supplier Catalog Number: CNA16231T
Alternative Catalog Number: MBL-CNA16231T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human MRPL18 (NP_054880.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 29074
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEA
Target: MRPL18
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200